LabDAO | Tools for the Next Frontier
LabDAO is an online life science research collective.
We provide and use open tools and infrastructure for computational life science research.
Access models for protein binder design, protein folding, and many more. Instead of setting up an open source model locally, get started immediately. Don't see a model you need? Let us know !
Instead of spending time setting up and hosting a tool locally, interact with clearly defined input fields, get access to all parameters and kick off multiple jobs in parallel.
No more crashing notebooks and lost files. Track your experiments, explore results, and download files easily.
tools
We onboard computational and laboratory applications required for high-impact life science research. By using an open-source peer-to-peer exchange protocol, members can collaborate globally without intermediaries.
explore tools
read the docs
community
Our community consists of students, researchers, and engineers across the computational and pre-clinical life sciences. Join the community, learn from peers and form new ideas together.
apply to join
find talent
projects
Have a project you are working on? Launch a project or apply to join an existing one. Our community can help you with questions ranging from grant opportunities, to cloud computing, to digital entity formation.
explore projects
create a project
We’re a group of scientists, operators, and engineers who’ve experienced the limits of academia first hand.
interested in joining our team?
If you’re interested in building a scientific organization for the 21st century, get in touch.
join community
create a project
{
"input": [
{
"name": "gp47_tail",
"sequence": "MTANHLESPNCDWKNNRMAIVHMVNVTPLRMMEEPRAAVEAAFEGIMEPAVVGDMVEYWNKMISTCCNYYQMGSSRSHLEEKAQMVDRFWFCPCIYYASGKWRNMFLNILHVWGHHHYPRN DLKPCSYLSCKLPDLRIFFNHMQTCCHFVTLLFLTEWPTYMIYNSVDLCPMTIPRRNTCRTMTEVSSWCEPAIPEWWQATVKGGWMSTHTKFCWYPVLDPHHEYAESKMDTYGQCKKGGMV. RCYKHKQQVWGNNHNESKAPCDDQPTYLCPPGEVYKGDHISKREAENMTNAWLGEDTHNFMEIMHCTAKMASTHFGSTTIYWAWGGHVRPAATWRVYPMIQEGSHCQC", "parameters": {
" max_template_date": "2022-01-01",
"mode": "monomer_single",
"weights_download_url": "https://storage.googleapis.com/alphafold/alphafold\_params\_2021-10-27.tar",
"db": "full",
"is_prokaryote": 0
}
}
]
}
thanks for reaching out! a member of our team will be in touch 🙂
Oops! something just went wrong. mind trying one more time?